PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0007s0384.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family CPP
Protein Properties Length: 1284aa    MW: 128890 Da    PI: 5.9879
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0007s0384.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.18.5e-143066441
                  TCR  4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                         k+CnCkk +Clk+YC Cf+ag++Cs+ C C +C N+ +
  Vocar.0007s0384.1.p 30 KRCNCKKARCLKLYCVCFSAGVYCSD-CACRECLNTLD 66
                         89************************.********876 PP

2TCR41.92e-13101138239
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          +kkgC+C++s+C+kkYCeCf a+++Cs +C+Ce+C N 
  Vocar.0007s0384.1.p 101 HKKGCRCRRSRCVKKYCECFDAQVYCSGSCRCEHCLNL 138
                          79**********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.0E-122767IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.51128140IPR005172CRC domain
PfamPF036389.6E-113064IPR005172CRC domain
SMARTSM011144.0E-9100141IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.4E-11102137IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1284 aa     Download sequence    Send to blast
MSAIKDHDAF NAANDSAVDI ADFSYTAGIK RCNCKKARCL KLYCVCFSAG VYCSDCACRE  60
CLNTLDNRDL VHAERTKKLA ASPGAFAPKV ELKAEGEMAC HKKGCRCRRS RCVKKYCECF  120
DAQVYCSGSC RCEHCLNLPK GGAPVLAPIP HVSLPPAHGG PSDLLSRFPT ADGADGGPGG  180
VAPITASVAA AAAAATAAAA ALHENTLAVV VNSAAAAGTE LDMGALDPHV GGLRATGRNG  240
VAASGGTLTA HGSLPFATAP SGTGSFLLSL HSGPLEFSGL SFLGNPEAAA AEKLGVGVVM  300
AGEVAATDRD GVLGPRLDAG AFTMGPGKST MPDGSLQALP GGVAVGMEAH VATPIVPSPA  360
LRRPPTSVFT FAGAQAEAVL AAQEQAGAPA NAAAALQSAP DDATTATAAA APLCETGMCA  420
GVPLLAEDGC SNGGGFAAGP AVGAAPPGST TGCSAGGGGE GDGCPRAAAD GEGKAHEHAQ  480
ALRRRISSDP EEDAEALRAG ASRTGPGPPA ALDSLPLMPA ASGTAHAGDP LLHEAGPPAV  540
AAVVATTSTT KLDPAPAAAG AAAAVEPAAA AAPAERPGPT HIGEAAGETA GTAEAPPVPP  600
ELMACSDDGG GTASEEMSAM EAVLAAPLLL LEEPLRAEEL AAQLGLDVPQ RLAARKAAHI  660
LRTLLCMASS TVQLTRSGAV GDSSHRWEQS LSRRGPAASH TQLLASHGLL APWAATTGNA  720
AAKPTVTTAA AATAPSLRAL GGRGQGDQPD QQPDPLHQQQ QPPPHGTLPP QGSCQQQQQH  780
QQHSFLGAAA LPAAMAERHE FVGTTTGGGQ DGCGAKQQDA ATQPGALPAR ILNLPPLHLP  840
PLSFSCVSGG SGTGGAAASG GGGTGGGGGG VRLGYGSYLF SAAGRLTGPE VSAMSGSHVD  900
GNAQEAGTNA GPAAAAGVAV QMAATGTTPT TIMSAISPGP GSRYRGGMAP AVRSTAGHEA  960
GLDSPLGPLR GVSVGAAAMA VGRRPSHDGE QQRLLRRGSR VKRPNSLLAD MELEEGIERL  1020
VDGRLERRRL HGVPTGHMHG RRIHHLQPHL QDQQHPSHRH RAISSSADPP SPKRSRFTAR  1080
GGAWQQGGSG GGGVDRRGGS WCVDDDAAED GQVEGEEEED DEEEQWESCG GREDSEAGRA  1140
SALRVRALSP YAEGQLPGNH QHHSQHHNYG AGLAIEDQYT TGREPTRQSL RSRSKTPRAL  1200
GGLAAPARQV DDDGVADTGH DVGAGRGKTG EELEDEDGGE RWGLATSEGE DSGGNCASEM  1260
EAMQALFDLR TAAAASVAAS AGL*
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3231530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.16e-30Tesmin/TSO1-like CXC domain-containing protein